Puzzle Printery
Home › Cryptograms › Pack 4

Cryptogram pack 4: Friendship

Cryptogram Pack 4
five friendship quotations in substitution cipher · puzzleprintery.com
Cryptogram pack 4 printable previewPreview the printed sheet

Five quotations on friendship, each encrypted with its own letter substitution. A stands for a different letter in every puzzle, and no letter ever stands for itself. Type in the boxes to solve on screen, or print the pack.

Download PDF (with answer key)

Puzzle 1 by Confucius

VGVUHEUOWETUEBOCZMSVZHNGKERZMSEROMOS?
Show answer

Is it not a joy to have friends come from afar?

Confucius, Analects, classic translation

Puzzle 2 by Ralph Waldo Emerson

HLMTIUZQYZHTLYKMYNSPMIWPAHTCMTIM.
Show answer

The only way to have a friend is to be one.

Ralph Waldo Emerson, Essays, Friendship, 1841

Puzzle 3 by George Eliot

KSMVKFDKJHDBLGKRJHHKWFHCJMHSQD;UGHPKDISNEBHDUMNSD,UGHPXKDDSNLJMUMLMDVD.
Show answer

Animals are such agreeable friends; they ask no questions, they pass no criticisms.

George Eliot, Scenes of Clerical Life, 1857

Puzzle 4 by Francis Bacon

AJOLYZFMONZTRPGLUMITSF,VYZERUULUMKJOLAFOYMVGXLF.
Show answer

Friendship doubleth joys, and cutteth griefs in halves.

Francis Bacon, Of Friendship, 1625

Puzzle 5 by Alfred, Lord Tennyson

'LEMFCLLCGLTNIKCPTKCVIRVPTMLLNIRRCKCGLTNIKCPTKCVILIPP.
Show answer

'tis better to have loved and lost than never to have loved at all.

Alfred, Lord Tennyson, In Memoriam, 1850

All quotations are public domain, attributed as printed. Free to print for personal, classroom, church and senior-activity use. Not for resale.

Previous packNext pack